Return to main results Retrieve Phyre Job Id

Job DescriptionP52073
Confidence19.65%DateThu Jan 5 12:05:09 GMT 2012
Rank87Aligned Residues34
% Identity26%Templatec2rq7A_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:atp synthase epsilon chain; PDBTitle: solution structure of the epsilon subunit chimera combining2 the n-terminal beta-sandwich domain from t. elongatus bp-13 f1 and the c-terminal alpha-helical domain from spinach4 chloroplast f1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   120.........130.........140.........150.........160...
Predicted Secondary structure 






















Query SS confidence 











































Query Sequence  FVLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVL
Query Conservation   
  
 

   
 
   
    
   
 

  
  








Alig confidence 





















..........











Template Conservation 
 
 
 



        
  
..........      
  


Template Sequence  MVMTVRVIAPDKTVWDAPAEEV. . . . . . . . . . ILPSTTGQLGIL
Template Known Secondary structure 


SSSS..........

TTS
Template Predicted Secondary structure 






..........




Template SS confidence 











































   1........10.........20.. .......30....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions