Return to main results Retrieve Phyre Job Id

Job DescriptionP75737
Confidence31.25%DateThu Jan 5 12:13:36 GMT 2012
Rank6Aligned Residues28
% Identity29%Templated1j7ga_
SCOP infoDTD-like DTD-like DTD-like
Resolution1.64

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   106...110.........120.........130.........140....
Predicted Secondary structure 















Query SS confidence 






































Query Sequence  YTSFFMRVCQGKPGTRPIVNEDYVSESGFFGSMMHVGII
Query Conservation 






































Alig confidence 












...........














Template Conservation 
  
   
     ...........
  
 


 
 
 
 
Template Sequence  YEYFIQKCAEKLP. . . . . . . . . . . VSTGQFAADMQVSLT
Template Known Secondary structure  TTS
...........

TTS

Template Predicted Secondary structure 



...........






Template SS confidence 






































   106...110........ .120.........130...
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions