Return to main results Retrieve Phyre Job Id

Job DescriptionP76192
Confidence10.32%DateThu Jan 5 12:20:18 GMT 2012
Rank73Aligned Residues25
% Identity32%Templated2jeka1
SCOP infoRv1873-like Rv1873-like Rv1873-like
Resolution1.38

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   653......660.........670.........680.....
Predicted Secondary structure 












Query SS confidence 
































Query Sequence  DDMHASLTMFYKEMGWDPQLGCPTRETLQRLGL
Query Conservation     
  
  

  



 
 
 

 
 
  


Alig confidence 










.......
.












Template Conservation    
  

    ....... .
  
  

  
  
Template Sequence  QDFVALLAKYY. . . . . . . G. GGEDRRTVALLAV
Template Known Secondary structure  S.......T.T



Template Predicted Secondary structure  .......
.





Template SS confidence 
































   120.........130 . ........140....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions