Return to main results Retrieve Phyre Job Id

Job DescriptionP76558
Confidence94.49%DateThu Jan 5 12:24:36 GMT 2012
Rank161Aligned Residues54
% Identity15%Templatec1zfnA_
PDB info PDB header:transferaseChain: A: PDB Molecule:adenylyltransferase thif; PDBTitle: structural analysis of escherichia coli thif
Resolution2.75 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   147..150.........160.........170.........180.........190.........200.........210.........220
Predicted Secondary structure 




















Query SS confidence 









































































Query Sequence  EQKLRERMNIPVFHDDQHGTAIISTAAILNGLRVVEKNISDVRMVVSGAGAAAIACMNLLVALGLQKHNIVVCD
Query Conservation 
        

 








 
 




 


  
  
 
  

  





 


 

   
     
   
Alig confidence 


















..................



























..






Template Conservation    

 


 
   
   
 .................. 
    




 




 
   

  

..
 
 


Template Sequence  FMRYSRQILLDDIALDGQQ. . . . . . . . . . . . . . . . . . KLLDSQVLIIGLGGLGTPAALYLAGAGV. . GTLVLAD
Template Known Secondary structure  TTSTTT..................


STTTT
..S
Template Predicted Secondary structure 

..................






..

Template SS confidence 









































































   6...10.........20.... .....30.........40.........50.. .......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions