Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7L3
Confidence3.39%DateThu Jan 5 11:05:51 GMT 2012
Rank70Aligned Residues25
% Identity24%Templatec3hl6B_
PDB info PDB header:unknown functionChain: B: PDB Molecule:pathogenicity island protein; PDBTitle: staphylococcus aureus pathogenicity island 3 orf9 protein
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   7980... ......90......... 100...
Predicted Secondary structure  .....




..
Query SS confidence 




. . . . .















. .



Query Sequence  FINGL. . . . . KKASVEIDRKILADIA. . VFDK
Query Conservation 

 

.....    
 






 

..
 

Alig confidence 




.....















..



Template Conservation 




 
 



 


 
 
 










Template Sequence  FMYGLQTYASSNTDVIANIEMLYQLATGINEP
Template Known Secondary structure 





TT
SS
Template Predicted Secondary structure 








Template SS confidence 































   114.....120.........130.........140.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions