Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7L3
Confidence2.46%DateThu Jan 5 11:05:51 GMT 2012
Rank99Aligned Residues27
% Identity30%Templatec2kz3A_
PDB info PDB header:unknown functionChain: A: PDB Molecule:putative uncharacterized protein rad51l3; PDBTitle: backbone 1h, 13c, and 15n chemical shift assignments for human rad51d2 from 1 to 83
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   65....70.........80.........90.........
Predicted Secondary structure 








Query SS confidence 


































Query Sequence  INAAARQNGISYSKFINGLKKASVEIDRKILADIA
Query Conservation 



 
  
  

 

 

    
 






 

Alig confidence 
















........









Template Conservation   

 
 



 

   
........


 



 
Template Sequence  LEEVAQKCGLSYKALVA. . . . . . . . LRRVLLAQFS
Template Known Secondary structure  T

........
Template Predicted Secondary structure 



........
Template SS confidence 


































   36...40.........50.. .......60..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions