Return to main results Retrieve Phyre Job Id

Job DescriptionP0ADN2
Confidence23.42%DateThu Jan 5 11:21:25 GMT 2012
Rank8Aligned Residues32
% Identity19%Templatec1or7C_
PDB info PDB header:transcriptionChain: C: PDB Molecule:sigma-e factor negative regulatory protein; PDBTitle: crystal structure of escherichia coli sigmae with the cytoplasmic2 domain of its anti-sigma rsea
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70.........80.
Predicted Secondary structure 















Query SS confidence 








































Query Sequence  AFNELDLGKREPVTEEEKLFVAVCRGEREPVTEAERVWSKY
Query Conservation   
 

  
   
 
 

  

 
  
     
  

 



Alig confidence 









.....










....










Template Conservation   



 


 .....   

   
  ....
 
    
  
Template Sequence  QLSALMDGET. . . . . LDSELLNELAH. . . . NPEMQKTWESY
Template Known Secondary structure  TTS
.....

T....
Template Predicted Secondary structure 


.....

....
Template SS confidence 








































   5....10.... .....20..... ....30......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions