Return to main results Retrieve Phyre Job Id

Job DescriptionP77627
Confidence2.33%DateThu Jan 5 12:31:18 GMT 2012
Rank89Aligned Residues25
% Identity20%Templatec2kn2A_
PDB info PDB header:metal binding proteinChain: A: PDB Molecule:calmodulin; PDBTitle: solution structure of the c-terminal domain of soybean calmodulin2 isoform 4 fused with the calmodulin-binding domain of ntmkp1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   133......140........ .150.......
Predicted Secondary structure 



........


Query SS confidence 















. . . . . . . .








Query Sequence  NWLSEEESLWIQSRIH. . . . . . . . LRALRYYSN
Query Conservation 



  

      

........  

  
 
Alig confidence 















........








Template Conservation 
 
   

                    
 


Template Sequence  GQVNYEEFVKMMMTVRGGGGGNGWSRLRRKFSS
Template Known Secondary structure  SSTTT


T
Template Predicted Secondary structure 









Template SS confidence 
































   60.........70.........80.........90..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions