Return to main results Retrieve Phyre Job Id

Job DescriptionP76068
Confidence17.98%DateThu Jan 5 12:18:07 GMT 2012
Rank14Aligned Residues23
% Identity13%Templatec3ugsB_
PDB info PDB header:transferaseChain: B: PDB Molecule:undecaprenyl pyrophosphate synthase; PDBTitle: crystal structure of a probable undecaprenyl diphosphate synthase2 (upps) from campylobacter jejuni
Resolution2.46 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   53......60.. .......70.....
Predicted Secondary structure 
.........






Query SS confidence 









. . . . . . . . .












Query Sequence  EIIAGHGRVM. . . . . . . . . AAEMLKMDSVPVI
Query Conservation   

 
  
  .........

  

   

  
Alig confidence 









.........












Template Conservation 







 
   
  

 

   

  



Template Sequence  VVMDGNRSQGVKTMQKLMEVCMEENISNLSLF
Template Known Secondary structure 




TT

Template Predicted Secondary structure 






Template SS confidence 































   910.........20.........30.........40
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions