Return to main results Retrieve Phyre Job Id

Job DescriptionP0AC96
Confidence1.00%DateThu Jan 5 11:17:40 GMT 2012
Rank77Aligned Residues32
% Identity25%Templatec3ia0c_
PDB info PDB header:structural proteinChain: C: PDB Molecule:ethanolamine utilization protein euts; PDBTitle: ethanolamine utilization microcompartment shell subunit,2 euts-g39v mutant
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   131........140.........150.........160.........170.
Predicted Secondary structure 








Query SS confidence 








































Query Sequence  SMARHTGTNLVKLVIPLFAGVAAAAAFLVPGPAPMLLASQM
Query Conservation   
    
                           
      
Alig confidence 









.........





















Template Conservation   
  


   .........  








 

 






Template Sequence  ELAKKIGVPD. . . . . . . . . AVAIGIMTLTPGETAMIAGDLA
Template Known Secondary structure  T

S.........SSSTT
Template Predicted Secondary structure 



.........





Template SS confidence 








































   28.30....... ..40.........50.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions