Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF12
Confidence92.31%DateThu Jan 5 11:30:44 GMT 2012
Rank94Aligned Residues27
% Identity30%Templatec4a17Y_
PDB info PDB header:ribosomeChain: Y: PDB Molecule:rpl37a; PDBTitle: t.thermophila 60s ribosomal subunit in complex with2 initiation factor 6. this file contains 5s rrna,3 5.8s rrna and proteins of molecule 2.
Resolution3.52 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   8.10.........20.........30.........40
Predicted Secondary structure 






















Query SS confidence 
































Query Sequence  CPSCSATDGVVRNGKSTAGHQRYLCSHCRKTWQ
Query Conservation 

 

    
 
 
    
 


 

 
  

 
Alig confidence 





.









.....










Template Conservation 

 


.  


   

.....
 




   
Template Sequence  CPFCGK. VAVKRAAVGI. . . . . WKCKPCKKIIA
Template Known Secondary structure 
TTT

.TT.....TTTT
Template Predicted Secondary structure 





.
.....




Template SS confidence 
































   3940.... .....50.... .....60.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions