Return to main results Retrieve Phyre Job Id

Job DescriptionP75831
Confidence97.08%DateThu Jan 5 12:14:48 GMT 2012
Rank129Aligned Residues39
% Identity26%Templated1qhla_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases ABC transporter ATPase domain-like
Resolution2.20

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.....
Predicted Secondary structure 


















Query SS confidence 


















































Query Sequence  LELKDIRRSYPAGDEQVEVLKGISLDIYAGEMVAIVGASGSGKSTLMNILG
Query Conservation 
                  
         
    
 
  
 




   
 
Alig confidence 






...........











.



















Template Conservation 
 
 
  ...........      
 
   .

 
 
 








 

 
Template Sequence  LTLINWN. . . . . . . . . . . GFFARTFDLDEL. VTTLSGGNGAGKSTTMAAFV
Template Known Secondary structure  T...........T
.S

S
Template Predicted Secondary structure 

...........






.





Template SS confidence 


















































   10...... ...20........ .30.........40........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions