Return to main results Retrieve Phyre Job Id

Job DescriptionP0A7S3
Confidence2.54%DateThu Jan 5 11:06:07 GMT 2012
Rank90Aligned Residues27
% Identity19%Templatec1gkpD_
PDB info PDB header:hydrolaseChain: D: PDB Molecule:hydantoinase; PDBTitle: d-hydantoinase (dihydropyrimidinase) from thermus sp. in2 space group c2221
Resolution1.29 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   57..60.........70.........80.........90
Predicted Secondary structure 





















Query SS confidence 

































Query Sequence  LTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDL
Query Conservation 




 
 













 






  

Alig confidence 







....


...















Template Conservation 
 

 
  ....   ...     
 
  
 
  
Template Sequence  IKNGEIIT. . . . ADS. . . RYKADIYAEGETITRI
Template Known Secondary structure  ....TT...SSSB

Template Predicted Secondary structure 


....


...


Template SS confidence 

































   5....10.. ... ....20.........30.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions