Return to main results Retrieve Phyre Job Id

Job DescriptionP05052
Confidence46.78%DateThu Jan 5 10:58:39 GMT 2012
Rank397Aligned Residues60
% Identity10%Templatec2vt2A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:redox-sensing transcriptional repressor rex; PDBTitle: structure and functional properties of the bacillus2 subtilis transcriptional repressor rex
Resolution2.3 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   136...140.........150.........160.........170.........180.........190.........200.........210.....
Predicted Secondary structure 






















Query SS confidence 















































































Query Sequence  TFTCKITGIISFNIERQWHLKDIAELIYTSESLIKKRLRDEGTSFTEILRDTRMRYAKKLITSNSYSINVVAQKCGYNST
Query Conservation       
   
        

  

     
   
 
 

  
 
   

   

  
  

     

 


   

   
Alig confidence 









































...............................



.

Template Conservation    
 
 
  
   
   


 


   

   






 

...............................  

. 
Template Sequence  PLYYRFLKNLHASGKQRVSSAELSDAVKVDSATIRRDFSYFG. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . ALGY. NV
Template Known Secondary structure  TT





TT...............................


.
Template Predicted Secondary structure 







...............................



.
Template SS confidence 















































































   17..20.........30.........40.........50........ .60.. ..
 
   216...220.......
Predicted Secondary structure 
Query SS confidence 











Query Sequence  SYFICAFKDYYG
Query Conservation 
 
 
 


  
Alig confidence 











Template Conservation    
   
   

Template Sequence  DYLLSFFRKTLD
Template Known Secondary structure 
Template Predicted Secondary structure 
Template SS confidence 











   70.........80.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions