Return to main results Retrieve Phyre Job Id

Job DescriptionP0AAL9
Confidence9.19%DateThu Jan 5 11:13:15 GMT 2012
Rank7Aligned Residues30
% Identity23%Templatec3gitA_
PDB info PDB header:transferaseChain: A: PDB Molecule:carbon monoxide dehydrogenase/acetyl-coa synthase subunit PDBTitle: crystal structure of a truncated acetyl-coa synthase
Resolution3.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   68.70.........80.........90.........100........
Predicted Secondary structure 























Query SS confidence 








































Query Sequence  NACCTIYKNRSSTCREFAMSGENGVVNEACNRARAKYGLTP
Query Conservation     
 


 

  

 

           
  

   

  
Alig confidence 



















...........









Template Conservation   









 




 
 ...........
 


 
  
Template Sequence  NHVCIVTPERVGLCGAVSWL. . . . . . . . . . . DAKASYEINH
Template Known Secondary structure  T

BTTB

TTS


...........
T
Template Predicted Secondary structure 












...........




Template SS confidence 








































   515....520.........530.... .....540....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions