Return to main results Retrieve Phyre Job Id

Job DescriptionP0A703
Confidence48.79%DateThu Jan 5 11:04:20 GMT 2012
Rank122Aligned Residues23
% Identity26%Templatec3gn5B_
PDB info PDB header:dna binding proteinChain: B: PDB Molecule:hth-type transcriptional regulator mqsa (ygit/b3021); PDBTitle: structure of the e. coli protein mqsa (ygit/b3021)
Resolution2.15 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   72...... .80.... .....90....
Predicted Secondary structure 




.................





.









Query SS confidence 






. . . . . . . . . . . . . . . . .





.









Query Sequence  WCWDCSQ. . . . . . . . . . . . . . . . . VVEIHQ. HDAQCPLCHG
Query Conservation   
  

 .................      .    

 


Alig confidence 






.................





.









Template Conservation 


 

               

    
       
  


Template Sequence  KCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEE
Template Known Secondary structure  B
TTTSSSBTTTTT

Template Predicted Secondary structure 


















Template SS confidence 








































   2.......10.........20.........30.........40..
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions