Return to main results Retrieve Phyre Job Id

Job DescriptionP0A703
Confidence21.81%DateThu Jan 5 11:04:20 GMT 2012
Rank230Aligned Residues22
% Identity14%Templatec2en6A_
PDB info PDB header:transcriptionChain: A: PDB Molecule:zinc finger protein 268; PDBTitle: solution structure of the c2h2 type zinc finger (region 887-2 919) of human zinc finger protein 268
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   71........80 .........90...
Predicted Secondary structure 






............












Query SS confidence 









. . . . . . . . . . . .












Query Sequence  AWCWDCSQVV. . . . . . . . . . . . EIHQHDAQCPLCH
Query Conservation    
  

   ............        

 

Alig confidence 









............








.


Template Conservation    
  
 
 
   
 
  
   
  


  
. 

Template Sequence  YGCNECGKTFSQKSILSAHQRTHTGEKPSGP. SSG
Template Known Secondary structure  TTTTSSSS


SSS.


Template Predicted Secondary structure 


















.


Template SS confidence 


































   13......20.........30.........40... ...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions