Return to main results Retrieve Phyre Job Id

Job DescriptionP0A703
Confidence56.83%DateThu Jan 5 11:04:20 GMT 2012
Rank93Aligned Residues29
% Identity38%Templatec2e2zA_
PDB info PDB header:protein transport, chaperone regulatorChain: A: PDB Molecule:tim15; PDBTitle: solution nmr structure of yeast tim15, co-chaperone of2 mitochondrial hsp70
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6970....... ..80.........90.......
Predicted Secondary structure 



.........


















Query SS confidence 








. . . . . . . . .



















Query Sequence  AQAWCWDCS. . . . . . . . . QVVEIHQHDAQCPLCHGERL
Query Conservation      
  

.........           

 


   
Alig confidence 








.........



















Template Conservation 
 


  
  

 
 


 

  




 
 

 
 

Template Sequence  IAFTCKKCNTRSSHTMSKQAYEKGTVLISCPHCKVRHL
Template Known Secondary structure  TTTTTS
TTT

Template Predicted Secondary structure 



















Template SS confidence 





































   12.......20.........30.........40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions