Return to main results Retrieve Phyre Job Id

Job DescriptionP15043
Confidence75.98%DateThu Jan 5 11:34:25 GMT 2012
Rank354Aligned Residues35
% Identity23%Templatec2f1rA_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:molybdopterin-guanine dinucleotide biosynthesis PDBTitle: crystal structure of molybdopterin-guanine biosynthesis2 protein b (mobb)
Resolution2.10 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   43......50.........60.........70.........80.........90........
Predicted Secondary structure 
















Query SS confidence 























































Query Sequence  CLVVMPTGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNST
Query Conservation 


  







 
 



      





 

  


  
   

    
 
 
Alig confidence 












.....................





















Template Conservation 
 
 
  





.....................

  
   
   
     
   
Template Sequence  LSIVGTSDSGKTT. . . . . . . . . . . . . . . . . . . . . LITRMMPILRERGLRVAVVKRK
Template Known Secondary structure  S
.....................TT



Template Predicted Secondary structure 





.....................




Template SS confidence 























































   5....10....... ..20.........30.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions