Return to main results Retrieve Phyre Job Id

Job DescriptionP0AEZ9
Confidence54.08%DateThu Jan 5 11:24:43 GMT 2012
Rank159Aligned Residues43
% Identity16%Templated1u0ta_
SCOP infoNAD kinase/diacylglycerol kinase-like NAD kinase/diacylglycerol kinase-like NAD kinase-like
Resolution2.30

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.........60.........70........
Predicted Secondary structure 
























Query SS confidence 































































Query Sequence  ILTVSNRRGEEDDTSGHYLRDSAQEAGHHVVDKAIVKENRYAIRAQVSAWIASDDVQVVLITGG
Query Conservation 



 
  
   
 
   
   
   
  
     
 

   
   
  
      







Alig confidence 





























.....................












Template Conservation 
 

              
   
   
   .....................     
 

 


Template Sequence  VLLVVHTGRDEATETARRVEKVLGDNKIAL. . . . . . . . . . . . . . . . . . . . . RVLSCELVLVLGG
Template Known Secondary structure  SSSGGGGSTTT
.....................




Template Predicted Secondary structure 






.....................





Template SS confidence 































































   7..10.........20.........30...... ...40.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions