Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9E0
Confidence94.31%DateThu Jan 5 11:09:58 GMT 2012
Rank112Aligned Residues46
% Identity24%Templatec3h5tA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcriptional regulator, laci family; PDBTitle: crystal structure of a transcriptional regulator, lacl2 family protein from corynebacterium glutamicum
Resolution2.53 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   193......200.........210.........220.........230.........240.........250.....
Predicted Secondary structure 
















Query SS confidence 






























































Query Sequence  SNFDIASVAQHVCLSPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTTRMPIATVGRNVGF
Query Conservation     

  

     
   
 
 

   
 
   

   

  
  

  
  

 


   

Alig confidence 
































...


..............









Template Conservation 
 


 


   


  






    

  
...
 
..............
   
  


Template Sequence  QYGTLASIAAKLGISRTTVSNAYNRPEQLSAEL. . . RQR. . . . . . . . . . . . . . ILDTAEDMGY
Template Known Secondary structure 
TTTS

GGGS
.................TT
Template Predicted Secondary structure 













.................

Template SS confidence 






























































   8.10.........20.........30.........40 ... ......50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions