Return to main results Retrieve Phyre Job Id

Job DescriptionP0A6K6
Confidence13.84%DateWed Jan 25 15:20:15 GMT 2012
Rank70Aligned Residues49
% Identity10%Templatec2f00A_
PDB info PDB header:ligaseChain: A: PDB Molecule:udp-n-acetylmuramate--l-alanine ligase; PDBTitle: escherichia coli murc
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.........60......
Predicted Secondary structure 








































Query SS confidence 

































































Query Sequence  MKRAFIMVLDSFGIGATEDAERFGDVGADTLGHIAEACAKGEADNGRKGPLNLPNLTRLGLAKAHE
Query Conservation 

 
  



 

  
  
         
 
 
 


     
   
   
 




 

  
  
Alig confidence 






...











...........














...














Template Conservation   
 
  
...
 

 
 
 

 ........... 
   
  
   
  ...       
   

  
Template Sequence  VRHIHFV. . . GIGGAGXGGIAE. . . . . . . . . . . VLANEGYQISGSDLA. . . PNPVTQQLXNLGATI
Template Known Secondary structure 

...TTTSTT...........TT

SS...

TT
Template Predicted Secondary structure 

...



...........




...




Template SS confidence 

































































   1920..... ....30....... ..40.........50.. .......60.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions