Return to main results Retrieve Phyre Job Id

Job DescriptionP36562
Confidence9.31%DateThu Jan 5 11:53:20 GMT 2012
Rank97Aligned Residues35
% Identity23%Templatec2we7A_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:xanthine dehydrogenase; PDBTitle: crystal structure of mycobacterium tuberculosis rv0376c2 homologue from mycobacterium smegmatis
Resolution2.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   56...60.........70.........80.........90.........100.........110....
Predicted Secondary structure 


























Query SS confidence 


























































Query Sequence  PHVGKKAVLVMCADHGVWEEGVAISPKEVTAIQAENMTRGTTGVCVLAEQAGANVHVID
Query Conservation 
        







  




 
 


   
 
   
 
 
  

   
  
 


Alig confidence 














........................



















Template Conservation     
   
 





........................

  

 

  


 
 


Template Sequence  SYAPRPRXLVFGAID. . . . . . . . . . . . . . . . . . . . . . . . FAAAVAQQGAFLGYRVTVCD
Template Known Secondary structure 





ST........................TT
Template Predicted Secondary structure 






........................



Template SS confidence 


























































   200.........210.... .....220.........230....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions