Return to main results Retrieve Phyre Job Id

Job DescriptionP19319
Confidence62.80%DateThu Jan 5 11:37:17 GMT 2012
Rank117Aligned Residues39
% Identity8%Templatec3iwfA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:transcription regulator rpir family; PDBTitle: the crystal structure of the n-terminal domain of a rpir2 transcriptional regulator from staphylococcus epidermidis to 1.4a
Resolution1.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   473......480.........490.........500.........510.........520......
Predicted Secondary structure 



















Query SS confidence 





















































Query Sequence  VYDLVLANYGLDRGLEDENSAKDYAEIKPYTPAWGEQITGVPRQYIETIAREFA
Query Conservation 




                        



 

 






 
  


  
Alig confidence 








...............





























Template Conservation 

 


   ...............      

 


    

 


 

 



Template Sequence  IAQFILNYP. . . . . . . . . . . . . . . HKVVNXTSQEIANQLETSSTSIIRLSKKVT
Template Known Secondary structure 
...............TT

TS
S
Template Predicted Secondary structure 
...............





Template SS confidence 





















































   22.......30 .........40.........50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions