Return to main results Retrieve Phyre Job Id

Job DescriptionP19319
Confidence26.16%DateThu Jan 5 11:37:17 GMT 2012
Rank195Aligned Residues47
% Identity13%Templatec3ezfA_
PDB info PDB header:biosynthetic proteinChain: A: PDB Molecule:para; PDBTitle: partition protein
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   463......470.........480.........490.........500.........510.........520.....
Predicted Secondary structure 



























Query SS confidence 






























































Query Sequence  VDGNTCPVVSVYDLVLANYGLDRGLEDENSAKDYAEIKPYTPAWGEQITGVPRQYIETIAREF
Query Conservation   

  
 
 





                        



 

 






 
  


  
Alig confidence 

















................




























Template Conservation                    ................   
     
 
 
               
Template Sequence  YGGVGTIALRASALLKAM. . . . . . . . . . . . . . . . SYYQTFTRNAVAKLPKLSRRIVDQAIKEM
Template Known Secondary structure  TSSTT................




TSTT

Template Predicted Secondary structure 

................










Template SS confidence 






























































   5....10.........20.. .......30.........40.........50.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions