Return to main results Retrieve Phyre Job Id

Job DescriptionP19319
Confidence36.29%DateThu Jan 5 11:37:17 GMT 2012
Rank168Aligned Residues36
% Identity22%Templatec1tw3A_
PDB info PDB header:transferaseChain: A: PDB Molecule:carminomycin 4-o-methyltransferase; PDBTitle: crystal structure of carminomycin-4-o-methyltransferase2 (dnrk) in complex with s-adenosyl-l-homocystein (sah) and3 4-methoxy-e-rhodomycin t (m-et)
Resolution2.35 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   473......480.........490.........500.........510.........520........
Predicted Secondary structure 




















Query SS confidence 























































Query Sequence  VYDLVLANYGLDRGLEDENSAKDYAEIKPYTPAWGEQITGVPRQYIETIAREFADT
Query Conservation 




                        



 

 






 
  


  
  
Alig confidence 






....................




























Template Conservation 


 
  ....................
  
  


   
     
 
 
  
   
Template Sequence  LVDHILA. . . . . . . . . . . . . . . . . . . . GARTVKALAARTDTRPEALLRLIRHLVAI
Template Known Secondary structure  T....................T

BT

T
Template Predicted Secondary structure 
....................







Template SS confidence 























































   3940..... ....50.........60.........70....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions