Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB20
Confidence24.37%DateThu Jan 5 11:14:25 GMT 2012
Rank15Aligned Residues48
% Identity25%Templatec3qiiA_
PDB info PDB header:transcription regulatorChain: A: PDB Molecule:phd finger protein 20; PDBTitle: crystal structure of tudor domain 2 of human phd finger protein 20
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10........ .20.........30.........40.........50.........60.........70.......
Predicted Secondary structure 








...




























Query SS confidence 












. . .


























































Query Sequence  FGIGQQVRHSLLG. . . YLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDNGLPVHTYLAEAQLSSEL
Query Conservation 
 







   ...
 


 



      

            



 


          






    
Alig confidence 












...







....................













....












Template Conservation 
 

  
 


 

  
 
 
  
....................     
 
 



 ....   

   

  
Template Sequence  FQINEQVLACWSDCRFYPAKVTAV. . . . . . . . . . . . . . . . . . . . NKDGTYTVKFYDGV. . . . VQTVKHIHVKAFS
Template Known Secondary structure 

TT

TTS
....................
TTSTTS
....GGG

Template Predicted Secondary structure 








....................






....


Template SS confidence 










































































   87..90.........100.........110 .........120.... .....130.......
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions