Return to main results Retrieve Phyre Job Id

Job DescriptionP0AB20
Confidence22.15%DateThu Jan 5 11:14:25 GMT 2012
Rank17Aligned Residues35
% Identity20%Templatec2equA_
PDB info PDB header:protein bindingChain: A: PDB Molecule:phd finger protein 20-like 1; PDBTitle: solution structure of the tudor domain of phd finger2 protein 20-like 1
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   6...10........ .20.........30.........40.........50.........60
Predicted Secondary structure 








...





















Query SS confidence 












. . .









































Query Sequence  FGIGQQVRHSLLG. . . YLGVVVDIDPVYSLSEPSPDELAVNDELRAAPWYHVVMEDDN
Query Conservation 
 







   ...
 


 



      

            



 


    
Alig confidence 












...







....................













Template Conservation 
 

  
 


 

  


 
  
....................     
 
 



 
Template Sequence  FKAGEEVLARWTDCRYYPAKIEAI. . . . . . . . . . . . . . . . . . . . NKEGTFTVQFYDGV
Template Known Secondary structure 

TT

SSSS....................STTSSTTS
Template Predicted Secondary structure 







....................






Template SS confidence 

























































   87..90.........100.........110 .........120....
 
Download:Text version FASTA pairwise alignment 3D Model in PDB format

View in Jmol

Send structure to FirstGlance for more viewing options


Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions