Return to main results Retrieve Phyre Job Id

Job DescriptionP0AFD6
Confidence9.24%DateThu Jan 5 11:25:59 GMT 2012
Rank80Aligned Residues33
% Identity24%Templatec1moxB_
PDB info PDB header:transferase/growth factorChain: B: PDB Molecule:epidermal growth factor receptor; PDBTitle: crystal structure of human epidermal growth factor receptor (residues2 1-501) in complex with tgf-alpha
Resolution2.50 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   64.....70.........80.........90.........100.........110...
Predicted Secondary structure 






























Query SS confidence 

















































Query Sequence  NLCAVACPVGCISLQKAETKDGRWYPEFFRINFSRCIFCGLCEEACPTTA
Query Conservation    
   

  

                  

   

 

 
   

  
Alig confidence 









.................






















Template Conservation    

  

 
.................           
  
   


 
Template Sequence  GSCVRACGAD. . . . . . . . . . . . . . . . . SYEMEEDGVRKCKKCEGPCRKVC
Template Known Secondary structure  SBS


TT.................TT
SSS


Template Predicted Secondary structure 




.................
















Template SS confidence 

















































   281........290 .........300.........310...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions