Return to main results Retrieve Phyre Job Id

Job DescriptionP0A8V6
Confidence82.05%DateThu Jan 5 11:08:48 GMT 2012
Rank235Aligned Residues31
% Identity26%Templatec2elhA_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:cg11849-pa; PDBTitle: solution structure of the cenp-b n-terminal dna-binding2 domain of fruit fly distal antenna cg11849-pa
ResolutionUNK

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50...
Predicted Secondary structure 














Query SS confidence 






































Query Sequence  YIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQ
Query Conservation   
   
  
 
  
  



  

   



 





 
Alig confidence 









........




















Template Conservation 


 


 
 ........
 
 


 


  


  
 
Template Sequence  HAIQRIHDGE. . . . . . . . SKASVARDIGVPESTLRGWCK
Template Known Secondary structure  T
........
T

Template Predicted Secondary structure 


........



Template SS confidence 






































   30......... 40.........50.........60
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions