Return to main results Retrieve Phyre Job Id

Job DescriptionP06722
Confidence2.25%DateThu Jan 5 10:59:25 GMT 2012
Rank96Aligned Residues26
% Identity27%Templatec3t72o_
PDB info PDB header:transcription/dnaChain: O: PDB Molecule:pho box dna (strand 1); PDBTitle: phob(e)-sigma70(4)-(rnap-betha-flap-tip-helix)-dna transcription2 activation sub-complex
Resolution4.33 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   26...30.........40.........50.........
Predicted Secondary structure 















Query SS confidence 

































Query Sequence  GYTLGELAALVGLVTPENLKRDKGWIGVLLEIWL
Query Conservation 


  

               

  
 


  
Alig confidence 












........












Template Conservation    

 


  


........







   

Template Sequence  DYTLEEVGKQFDV. . . . . . . . TRERIRQIEAKAL
Template Known Secondary structure 


SS........
Template Predicted Secondary structure 




........
Template SS confidence 

































   570.........580.. .......590.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions