Return to main results Retrieve Phyre Job Id

Job DescriptionP06722
Confidence2.70%DateThu Jan 5 10:59:25 GMT 2012
Rank68Aligned Residues31
% Identity23%Templatec2bnoA_
PDB info PDB header:oxidoreductaseChain: A: PDB Molecule:epoxidase; PDBTitle: the structure of hydroxypropylphosphonic acid epoxidase2 from s. wedmorenis.
Resolution1.9 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50....
Predicted Secondary structure 
















Query SS confidence 






































Query Sequence  QLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVL
Query Conservation 

  
     


  

               

  
 
Alig confidence 






















........







Template Conservation    

  
   



 


   

........
   

 
Template Sequence  ELLKDRREQVKMDHAALASLLGE. . . . . . . . TPETVAAW
Template Known Secondary structure  TT

T
........
Template Predicted Secondary structure 





........
Template SS confidence 






































   13......20.........30..... ....40...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions