Return to main results Retrieve Phyre Job Id

Job DescriptionP06722
Confidence2.23%DateThu Jan 5 10:59:25 GMT 2012
Rank98Aligned Residues33
% Identity24%Templatec1y66D_
PDB info PDB header:de novo proteinChain: D: PDB Molecule:engrailed homeodomain; PDBTitle: dioxane contributes to the altered conformation and2 oligomerization state of a designed engrailed homeodomain3 variant
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   15....20.........30.........40.........50.........
Predicted Secondary structure 
















Query SS confidence 












































Query Sequence  EQLLAQAQQLSGYTLGELAALVGLVTPENLKRDKGWIGVLLEIWL
Query Conservation   

  
     


  

               

  
 


  
Alig confidence 




















............











Template Conservation 




















............











Template Sequence  KEFVRRHQEITQETLHEYAQK. . . . . . . . . . . . LGLNQQAIEQFF
Template Known Secondary structure  ............
Template Predicted Secondary structure  ............


Template SS confidence 












































   13......20.........30... ......40.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions