Return to main results Retrieve Phyre Job Id

Job DescriptionP0A9X4
Confidence94.62%DateThu Jan 5 11:11:37 GMT 2012
Rank108Aligned Residues231
% Identity16%Templatec3bf1C_
PDB info PDB header:transferaseChain: C: PDB Molecule:type iii pantothenate kinase; PDBTitle: type iii pantothenate kinase from thermotoga maritima2 complexed with pantothenate and adp
Resolution2.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   910... ......20.........30.........40.........50.........60.........70.........80.......
Predicted Secondary structure 


.































Query SS confidence 




.









































































Query Sequence  FSNDL. SIDLGTANTLIYVKGQGIVLNEPSVVAIRQDRAGSPKSVAAVGHDAKQMLGRTPGNIAAIRPMKDGVIADFFVT
Query Conservation   
  
.


 

    
           

 
               

  
                   
        
Alig confidence 




.
























..........................................






Template Conservation 
  
 
 





 

               .......................................... 
     
Template Sequence  MDPMYLLVDVGNTHSVFSITEDGKTFRRWRL. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . STGVFQT
Template Known Secondary structure 



SSSSSSS
..........................................

TT

Template Predicted Secondary structure 










..........................................






Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions