Return to main results Retrieve Phyre Job Id

Job DescriptionP52108
Confidence40.76%DateThu Jan 5 12:05:24 GMT 2012
Rank309Aligned Residues34
% Identity18%Templatec3qfnA_
PDB info PDB header:hydrolaseChain: A: PDB Molecule:putative uncharacterized protein; PDBTitle: crystal structure of streptococcal asymmetric ap4a hydrolase and2 phosphodiesterase spr1479/saph in complex with inorganic phosphate
Resolution2.31 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   1........10.........20.........30.........40.........50.
Predicted Secondary structure 













Query SS confidence 


















































Query Sequence  MNTIVFVEDDAEVGSLIAAYLAKHDMQVTVEPRGDQAEETILRENPDLVLL
Query Conservation 
 






       
   
   
  
  
    


        



 
Alig confidence 
















.................
















Template Conservation 



  




     
.................   
  
     
 

 
Template Sequence  MTKIALLSDIHGNTTAL. . . . . . . . . . . . . . . . . EAVLADARQLGVDEYWL
Template Known Secondary structure 



TT
.................TT

Template Predicted Secondary structure 







.................





Template SS confidence 


















































   3......10......... 20.........30......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions