Return to main results Retrieve Phyre Job Id

Job DescriptionP75796
Confidence98.21%DateThu Jan 5 12:14:14 GMT 2012
Rank95Aligned Residues39
% Identity31%Templatec3qkuB_
PDB info PDB header:replicationChain: B: PDB Molecule:dna double-strand break repair rad50 atpase; PDBTitle: mre11 rad50 binding domain in complex with rad50 and amp-pnp
Resolution3.30 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   13......20.........30.........40.........50.........60...
Predicted Secondary structure 

















Query SS confidence 


















































Query Sequence  LAVENLNIAFMQDQQKIAAVRNLSFSLQRGETLAIVGESGSGKSVTALALM
Query Conservation 
 
 

   
         
  


 
  

   


 









 
 
Alig confidence 





...........












.



















Template Conservation 
 
 

...........       
 
   .
 

 
 








 

 
Template Sequence  VTVKNF. . . . . . . . . . . RSHSDTVVEFKEG. INLIIGQNGSGKSSLLDAIL
Template Known Secondary structure  ...........TT

S.
TTSS
Template Predicted Secondary structure 

...........








.





Template SS confidence 


















































   6...10. ........20.... .....30.........40....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions