Return to main results Retrieve Phyre Job Id

Job DescriptionP76329
Confidence97.77%DateThu Jan 5 12:21:51 GMT 2012
Rank111Aligned Residues202
% Identity11%Templatec2w11B_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:2-haloalkanoic acid dehalogenase; PDBTitle: structure of the l-2-haloacid dehalogenase from sulfolobus2 tokodaii
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   5....10.........20.........30.........40.........50.........60.........70.........80....
Predicted Secondary structure 


































Query SS confidence 















































































Query Sequence  QQPLLVFSDLDGTLLDSHSYDWQPAAPWLTRLREANVPVILCSSKTSAEMLYLQKTLGLQGLPLIAENGAVIQLAEQWQE
Query Conservation      

  






     
      

  
   

 
 




                   
   
  
        
Alig confidence 






























.................................................
Template Conservation 
 

 








 
            
  .................................................
Template Sequence  SHMIILAFDIFGTVLDTSTVIQEFRNKQLEY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . .
Template Known Secondary structure 





BTTTB

TTS
.................................................
Template Predicted Secondary structure 










.................................................
Template SS confidence 















































































  
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions