Return to main results Retrieve Phyre Job Id

Job DescriptionP21517
Confidence88.71%DateThu Jan 5 11:38:27 GMT 2012
Rank281Aligned Residues44
% Identity14%Templated1jz8a5
SCOP infoTIM beta/alpha-barrel (Trans)glycosidases beta-glycanases
Resolution1.50

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   180.........190.........200.........210.........220.........230.........240.......
Predicted Secondary structure 
































Query SS confidence 



































































Query Sequence  DGISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQFGGDGALLRLRHNTQQLGMRLVLDG
Query Conservation   

  





 


  
 
 

       

   

  

   

  


 

   
  

 



 
Alig confidence 



















.........





...............

















Template Conservation 
    

 


  
 
 

 ......... 
 
  ...............  

   

 



  
 
Template Sequence  QTMVQDILLMKQNNFNAVRC. . . . . . . . . SHYPNH. . . . . . . . . . . . . . . PLWYTLCDRYGLYVVDEA
Template Known Secondary structure  TT


.........TTS


...............T

Template Predicted Secondary structure 



.........




...............




Template SS confidence 



































































   370.........380......... 390..... ....400.........410...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions