Return to main results Retrieve Phyre Job Id

Job DescriptionP21517
Confidence61.69%DateThu Jan 5 11:38:27 GMT 2012
Rank463Aligned Residues44
% Identity11%Templatec3m0zD_
PDB info PDB header:lyaseChain: D: PDB Molecule:putative aldolase; PDBTitle: crystal structure of putative aldolase from klebsiella2 pneumoniae.
Resolution1.20 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   182.......190.........200.........210.........220.........230.........240...
Predicted Secondary structure 
































Query SS confidence 





























































Query Sequence  ISEKLPYLKKLGVTALYLNPVFKAPSVHKYDTEDYRHVDPQFGGDGALLRLRHNTQQLGMRL
Query Conservation 
  





 


  
 
 

       

   

  

   

  


 

   
  

 
Alig confidence 




















......

............




















Template Conservation   
 
 

  
 
  



 

...... 
............ 
 
 

   




  

 
Template Sequence  LETAIALLKDXGGSSIKYFPX. . . . . . GG. . . . . . . . . . . . LKHRAEFEAVAKACAAHDFWL
Template Known Secondary structure  TT




......TT............TTTTT
Template Predicted Secondary structure 






......

............


Template SS confidence 





























































   144.....150.........160.... .. ...170.........180.......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions