Return to main results Retrieve Phyre Job Id

Job DescriptionP14294
Confidence85.36%DateThu Jan 5 11:33:58 GMT 2012
Rank50Aligned Residues46
% Identity24%Templatec2ev5B_
PDB info PDB header:transcriptionChain: B: PDB Molecule:transcriptional regulator mntr; PDBTitle: bacillus subtilis manganese transport regulator (mntr)2 bound to calcium
Resolution2.00 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   492.......500.........510.........520.........530.........540.........550.........560.
Predicted Secondary structure 




















Query SS confidence 





































































Query Sequence  TDATLLSAMTGIARFVQDKDLKKILRATDGLGTEATRAGIIELLFKRGFLTKKGRYIHSTDAGKALFHSL
Query Conservation 





  

   
 
 
      
  
 








 

  
  
 

    
 
 

  
  
   
Alig confidence 








....................

.




















...













Template Conservation      

  
.................... 
.   


  
  
   


 
 ...  

  
   
   
Template Sequence  RVSDIAEAL. . . . . . . . . . . . . . . . . . . . AV. HPSSVTKMVQKLDKDEYLIYG. . . LVLTSKGKKIGKRL
Template Known Secondary structure 
....................T
.
TTS

...

Template Predicted Secondary structure 
....................

.





...



Template SS confidence 





































































   24.....30.. .. .....40.........50..... ....60.........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions