Return to main results Retrieve Phyre Job Id

Job DescriptionP09323
Confidence92.59%DateThu Jan 5 11:02:10 GMT 2012
Rank42Aligned Residues39
% Identity31%Templatec3h9iB_
PDB info PDB header:transport proteinChain: B: PDB Molecule:cation efflux system protein cusb; PDBTitle: crystal structure of the membrane fusion protein cusb from escherichia2 coli
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   537..540.........550.........560.........570.........580.........590.........600.........
Predicted Secondary structure 































Query SS confidence 








































































Query Sequence  IVVSPAAGTIVKIFNTNHAFCLETEKGAEIVVHMGIDTVALEGKGFKRLVEEGAQVSAGQPILEMDLDYLNAN
Query Conservation   
 

  
 
     
 

       
 










 
 
  
   
  
  
  
  
   
   
   
Alig confidence 













..................................
























Template Conservation   
 
   
 
  
 .................................. 
  
  
 

  
  
        
Template Sequence  IVQARAAGFIDKVY. . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . PLTVGDKVQKGTPLLDLTIPDWVEA
Template Known Secondary structure  S



..................................S

SS

TT



Template Predicted Secondary structure 



..................................











Template SS confidence 








































































   123......130...... ...140.........150.........160.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions