Return to main results Retrieve Phyre Job Id

Job DescriptionP09130
Confidence95.42%DateThu Jan 5 11:01:56 GMT 2012
Rank233Aligned Residues41
% Identity24%Templated2fnaa2
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Extended AAA-ATPase domain
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   151........160.........170.........180.........190.........200.........
Predicted Secondary structure 
























Query SS confidence 


























































Query Sequence  QLTDNPKDVARMLKKDGKDSDIRIGDLPIIRDSEIQNFCLHGTVGAGKSEVIRRLANYA
Query Conservation                              
       
 



 





  
  

   
Alig confidence 















..................
























Template Conservation   
 

  

  
    ..................   
 
 
  
 





       
Template Sequence  DFFDREKEIEKLKGLR. . . . . . . . . . . . . . . . . . APITLVLGLRRTGKSSIIKIGINEL
Template Known Secondary structure  GS


T
..................SSSTTSS
Template Predicted Secondary structure 


..................








Template SS confidence 


























































   13......20........ .30.........40.........50...
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions