Return to main results Retrieve Phyre Job Id

Job DescriptionP09130
Confidence94.32%DateThu Jan 5 11:01:56 GMT 2012
Rank369Aligned Residues29
% Identity28%Templatec3geiB_
PDB info PDB header:hydrolaseChain: B: PDB Molecule:trna modification gtpase mnme; PDBTitle: crystal structure of mnme from chlorobium tepidum in complex2 with gcp
Resolution3.40 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   188.190.........200.........210.........220...
Predicted Secondary structure 












Query SS confidence 



































Query Sequence  FCLHGTVGAGKSEVIRRLANYARQRGDMVVIYDRSG
Query Conservation   



 





  
  

      
   

 



Alig confidence 


















.......









Template Conservation 




  








 
 .......   
  

 
Template Sequence  TVIAGKPNAGKSTLLNTLL. . . . . . . EECFIHDKTM
Template Known Secondary structure 

TTSS
.......

TT
Template Predicted Secondary structure 





.......





Template SS confidence 



































   233......240.........250. ........260.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions