Return to main results Retrieve Phyre Job Id

Job DescriptionP38035
Confidence95.38%DateThu Jan 5 11:57:48 GMT 2012
Rank145Aligned Residues30
% Identity33%Templated1rkba_
SCOP infoP-loop containing nucleoside triphosphate hydrolases P-loop containing nucleoside triphosphate hydrolases Nucleotide and nucleoside kinases
Resolution2.00

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   211........220.........230.........240........
Predicted Secondary structure 















Query SS confidence 





































Query Sequence  ILLNGPTGAGKSFLARRILELKQARHQFSGAFVEVNCA
Query Conservation      
  
 

   
   
  
    
   


 
 
 
Alig confidence 






















........






Template Conservation 
 
 
  






   

  

........   
   
Template Sequence  ILLTGTPGVGKTTLGKELASKSG. . . . . . . . LKYINVG
Template Known Secondary structure 
STTSS
........
Template Predicted Secondary structure 






........



Template SS confidence 





































   6...10.........20........ .30.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions