Return to main results Retrieve Phyre Job Id

Job DescriptionP38035
Confidence83.48%DateThu Jan 5 11:57:48 GMT 2012
Rank495Aligned Residues38
% Identity26%Templatec2o5vA_
PDB info PDB header:replication/recombinationChain: A: PDB Molecule:dna replication and repair protein recf; PDBTitle: recombination mediator recf
Resolution1.61 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   282.......290.. .......300.........310.........320.........330...
Predicted Secondary structure 



.













Query SS confidence 










.








































Query Sequence  NGGMLFLDEIG. ELGADEQAMLLKAIEEKTFYPFGSDRQVSSDFQLIAGTVRD
Query Conservation   



 



 . 
    
  

  
      
 
        



 

   
Alig confidence 










.

















..............








Template Conservation     







  


  
  
   
    ..............






  
Template Sequence  EDPVLLLDDFTAELDPHRRQYLLDLAASVP. . . . . . . . . . . . . . QAIVTGTEL
Template Known Secondary structure  S



GGG


SS..............SS
Template Predicted Secondary structure 











..............


Template SS confidence 




















































   292.......300.........310.........320. ........330
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions