Return to main results Retrieve Phyre Job Id

Job DescriptionP38035
Confidence95.25%DateThu Jan 5 11:57:48 GMT 2012
Rank152Aligned Residues31
% Identity35%Templatec2f6rA_
PDB info PDB header:transferaseChain: A: PDB Molecule:bifunctional coenzyme a synthase; PDBTitle: crystal structure of bifunctional coenzyme a synthase (coa synthase):2 (18044849) from mus musculus at 1.70 a resolution
Resolution1.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   211........220.........230.........240.........250
Predicted Secondary structure 
















Query SS confidence 







































Query Sequence  ILLNGPTGAGKSFLARRILELKQARHQFSGAFVEVNCATL
Query Conservation      
  
 

   
   
  
    
   


 
 
  
Alig confidence 





















.........








Template Conservation 
 
 
  







  
   
.........   
  
  
Template Sequence  LGLTGISGSGKSSVAQRLKNLG. . . . . . . . . AYIIDSDHL
Template Known Secondary structure 
TTS
T.........
Template Predicted Secondary structure 






.........

Template SS confidence 







































   66...70.........80....... ..90......
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions