Return to main results Retrieve Phyre Job Id

Job DescriptionP09152
Confidence32.31%DateThu Jan 5 11:02:00 GMT 2012
Rank181Aligned Residues35
% Identity29%Templatec1xduA_
PDB info PDB header:transferaseChain: A: PDB Molecule:protein rdmb; PDBTitle: crystal structure of aclacinomycin-10-hydroxylase (rdmb) in complex2 with sinefungin (sfg)
Resolution2.70 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   474.....480.........490.........500.........510.........520........
Predicted Secondary structure 



















Query SS confidence 






















































Query Sequence  VYDLTLANYGLERGLNDVNCATSYDDVKAYTPAWAEQITGVSRSQIIRIAREFAD
Query Conservation 




                        






 






 
  


  
 
Alig confidence 






....................



























Template Conservation 


 
  ....................
  
  


   
     
 
 
  
  
Template Sequence  LVDHLLA. . . . . . . . . . . . . . . . . . . . GADTLAGLADRTDTHPQALSRLVRHLTV
Template Known Secondary structure  T....................T

STTT

Template Predicted Secondary structure 

....................







Template SS confidence 






















































   41...... ..50.........60.........70.....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions