Return to main results Retrieve Phyre Job Id

Job DescriptionP09152
Confidence36.39%DateThu Jan 5 11:02:00 GMT 2012
Rank165Aligned Residues22
% Identity41%Templatec1nh2C_
PDB info PDB header:transcription/dnaChain: C: PDB Molecule:transcription initiation factor iia large chain; PDBTitle: crystal structure of a yeast tfiia/tbp/dna complex
Resolution1.90 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   41........50.........60.........70
Predicted Secondary structure 















Query SS confidence 





























Query Sequence  QHDKIVRSTHGVNCTGSCSWKIYVKNGLVT
Query Conservation    
         

   
     



 
 
Alig confidence 










........










Template Conservation   



 
 


........


 





 
Template Sequence  LYDKVTRTKAR. . . . . . . . WKCSLKDGVVT
Template Known Secondary structure  TT........
Template Predicted Secondary structure 

........
Template SS confidence 





























   247..250....... ..260........
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions