Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF89
Confidence91.90%DateThu Jan 5 11:31:47 GMT 2012
Rank138Aligned Residues57
% Identity23%Templatec3kxaD_
PDB info PDB header:structural genomics, unknown functionChain: D: PDB Molecule:putative uncharacterized protein; PDBTitle: crystal structure of ngo0477 from neisseria gonorrhoeae
Resolution2.80 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60.........70.........80.........90.....
Predicted Secondary structure 






























Query SS confidence 















































































Query Sequence  LWKNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATALNRSPSTISREV
Query Conservation      
     

   

       
                  

  

  
  
     
 
 

  

   


 


Alig confidence 
























..










.......................


















Template Conservation 
   



 


   


   

 
..
 
   

   .......................
 


  



  

 
  
Template Sequence  RXKKGFTQSELATAAGLPQPYLSRI. . ENSKQSLQDKT. . . . . . . . . . . . . . . . . . . . . . . VQKLANALGVSPLEVRAAF
Template Known Secondary structure  TT

TT

..T
S


.......................T

Template Predicted Secondary structure 





..






.......................


Template SS confidence 















































































   6970.........80.........90... ......100.... .....110.........120...
 
   96.
Predicted Secondary structure 
Query SS confidence 

Query Sequence  QR
Query Conservation   
Alig confidence 

Template Conservation 
 
Template Sequence  ER
Template Known Secondary structure  GG
Template Predicted Secondary structure 
Template SS confidence 

   124.
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions