Return to main results Retrieve Phyre Job Id

Job DescriptionP0CF89
Confidence93.89%DateThu Jan 5 11:31:47 GMT 2012
Rank104Aligned Residues49
% Identity20%Templatec3bs3A_
PDB info PDB header:dna binding proteinChain: A: PDB Molecule:putative dna-binding protein; PDBTitle: crystal structure of a putative dna-binding protein from bacteroides2 fragilis
Resolution1.65 Å

  Insertion relative to template
  Deletion relative to template
  Catalytic residue from the CSA
 
Detailed help on interpreting your alignment


   16...20.........30.........40.........50.........60.........70.........80.........
Predicted Secondary structure 






























Query SS confidence 









































































Query Sequence  LWKNGTGFSEIANILGSKPGTIFTMLRDTGGIKPHERKRAVAHLTLSEREEIRAGLSAKMSIRAIATALNRSPS
Query Conservation      
     

   

       
                  

  

  
  
     
 
 

  

   
Alig confidence 
























..










.......................












Template Conservation 
   
 

 


   


   

  ..
 
   
    .......................
  

  
 
   
Template Sequence  LAEKQRTNRWLAEQXGKSENTISRW. . CSNKSQPSLDX. . . . . . . . . . . . . . . . . . . . . . . LVKVAELLNVDPR
Template Known Secondary structure  TT

T

..TTSS


.......................TS
GG
Template Predicted Secondary structure 



..







.......................


Template SS confidence 









































































   16...20.........30.........40 .........50. ........60....
 
Download:Text version

No model constructed - rank, confidence too low




Phyre is for academic use only

Please cite: Protein structure prediction on the web: a case study using the Phyre server
Kelley LA and Sternberg MJE. Nature Protocols 4, 363 - 371 (2009) [pdf] [Import into BibTeX]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Benjamin Jefferys 
Disclaimer
Terms and Conditions